DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and USP6

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001291213.1 Gene:USP6 / 9098 HGNCID:12629 Length:1406 Species:Homo sapiens


Alignment Length:213 Identity:47/213 - (22%)
Similarity:73/213 - (34%) Gaps:67/213 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LASLLGLSNDEDQLQVAFDEVLKRRVPSRQPTNLRM------------SAPIR----YYYDLMSQ 54
            |..|.||::::..|....|..:|......|...|.:            |:||.    ...|..|.
Human   751 LRDLCGLNSEQILLAEVHDSNIKNFPQDNQKVQLSVSGFLCAFEIPVPSSPISASSPTQIDFSSS 815

  Fly    55 PS-RALFI----------IFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDN---GY 105
            || ..:|.          ||..:.||  :.||.....::.|...   :|  ..:|.:.|:   ||
Human   816 PSTNGMFTLTTNGDLPKPIFIPNGMP--NTVVPCGTEKNFTNGM---VN--GHMPSLPDSPFTGY 873

  Fly   106 KLAESVAILR----YLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFR------TV 160
            .:|....::|    :||     |:...|..|             .|.|.:.|.::.|      .|
Human   874 IIAVHRKMMRTELYFLS-----PQENRPSLF-------------GMPLIVPCTVHTRKKDLYDAV 920

  Fly   161 WLEPLLTGR--TPSEAKI 176
            |::.....|  .|.||.|
Human   921 WIQVSWLARPLPPQEASI 938

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 22/97 (23%)
GstA 47..243 CDD:223698 35/156 (22%)
GST_C_Theta 135..259 CDD:198292 11/50 (22%)
USP6NP_001291213.1 TBC 97..312 CDD:214540
DUF4607 <332..407 CDD:292024
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..380
UBP12 <528..1114 CDD:227847 47/213 (22%)
Peptidase_C19 533..>723 CDD:271592
Peptidase_C19 <1023..1367 CDD:271592
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1120..1231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1384..1406
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.