DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and CAM1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:56/235 - (23%)
Similarity:96/235 - (40%) Gaps:34/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 MSQPSRALFIIFRLSNMPFEDCVVALR----------NGEHLTEDFKKEINRFQRVPC-IHDNGY 105
            |||.:  |:..||:........|.||:          ..|....||.     .::||. :...||
Yeast     1 MSQGT--LYANFRIRTWVPRGLVKALKLDVKVVTPDAAAEQFARDFP-----LKKVPAFVGPKGY 58

  Fly   106 KLAESVAILRY---LSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLT 167
            ||.|::||..|   ||...|:...|... ..|.:...:.:.||.::....|.....|:  .||..
Yeast    59 KLTEAMAINYYLVKLSQDDKMKTQLLGA-DDDLNAQAQIIRWQSLANSDLCIQIANTI--VPLKG 120

  Fly   168 GRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTR----MADYDVR 228
            |...::..:::....:::.:|:.|. .|:...:|...::::||:.||...  ||    :...:.|
Yeast   121 GAPYNKKSVDSAMDAVDKIVDIFEN-RLKNYTYLATENISLADLVAASIF--TRYFESLFGTEWR 182

  Fly   229 IKYPKIRAWLKRVRQSCNPYY-DVAHEFVYKISGTGPQAK 267
            .::|.|..|...||.|  |:. |...:|.:......|..|
Yeast   183 AQHPAIVRWFNTVRAS--PFLKDEYKDFKFADKPLSPPQK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 24/82 (29%)
GstA 47..243 CDD:223698 49/208 (24%)
GST_C_Theta 135..259 CDD:198292 27/128 (21%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342 19/75 (25%)
GST_C_EF1Bgamma_like 92..214 CDD:198290 27/128 (21%)
EF1G 255..359 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345028
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.