DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GYP5

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_015075.1 Gene:GYP5 / 855827 SGDID:S000006170 Length:894 Species:Saccharomyces cerevisiae


Alignment Length:84 Identity:17/84 - (20%)
Similarity:41/84 - (48%) Gaps:9/84 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGLSNDEDQLQVAFDEVLKRRVPSRQPTN-LRMSAPIRYYYDLMSQPSRALFIIFRLSNMPFEDC 73
            :|:|.||| .|:....|.::|..:|:|:: :.::.|:....|:.:.       :...:.:..|..
Yeast    81 IGISGDED-TQITEQNVNEQRQETREPSSEIDLNEPLDVEKDVTTD-------VQAPNGLNIEKE 137

  Fly    74 VVALRNGEHLTEDFKKEIN 92
            ..|::..|.:..|.|:.::
Yeast   138 YDAVKENEKVYADTKEVVS 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 6/48 (13%)
GstA 47..243 CDD:223698 6/46 (13%)
GST_C_Theta 135..259 CDD:198292
GYP5NP_015075.1 COG5210 154..737 CDD:227535 0/3 (0%)
SMC_prok_B 726..>891 CDD:274008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.