DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and URE2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:281 Identity:59/281 - (20%)
Similarity:105/281 - (37%) Gaps:82/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QLQVAFDEVLKRRVPSRQPTNLRMSAPIRYY--YDLMSQPSRALFIIFRLSNMPFEDCVVAL--R 78
            |.|.||.::  ..|...:.|......|:..|  :...|.|: ...:...||.:.|....:.|  .
Yeast    86 QQQQAFSDM--SHVEYSRITKFFQEQPLEGYTLFSHRSAPN-GFKVAIVLSELGFHYNTIFLDFN 147

  Fly    79 NGEHLTEDFKKEINRFQRVPCIHDNG---YKLAESVAILRYLSAKGKIPEHLYPKYF-------- 132
            .|||...:| ..:|...|||.:.|:|   ..:.||.|||.          ||..||:        
Yeast   148 LGEHRAPEF-VSVNPNARVPALIDHGMDNLSIWESGAILL----------HLVNKYYKETGNPLL 201

  Fly   133 -----VDQSRVDEFLEWQ---HMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDV 189
                 .|||:::.:|.:|   |..: :..|::||....:.:.:.       :|.:..::.|...|
Yeast   202 WSDDLADQSQINAWLFFQTSGHAPM-IGQALHFRYFHSQKIASA-------VERYTDEVRRVYGV 258

  Fly   190 VEEVWLEGKD-------------------------------FLTGSSLTVADIFAACEIEQTRMA 223
            ||....|.::                               :|.|..||:||:   ..:....:.
Yeast   259 VEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVWLVGDKLTIADL---AFVPWNNVV 320

  Fly   224 D---YDVRIKYPKIRAWLKRV 241
            |   .:::|::|::..|.|.:
Yeast   321 DRIGINIKIEFPEVYKWTKHM 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 22/82 (27%)
GstA 47..243 CDD:223698 52/252 (21%)
GST_C_Theta 135..259 CDD:198292 25/144 (17%)
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 26/91 (29%)
GST_C_Ure2p 208..350 CDD:198326 26/145 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.