DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GYL1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_013917.1 Gene:GYL1 / 855230 SGDID:S000004804 Length:720 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:67/292 - (22%)
Similarity:99/292 - (33%) Gaps:105/292 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVSFLAS-----LLGLSNDEDQL--------QVAFDEVLKRR------VPSRQPT----NLRMSA 43
            |.|.|.|     |.|..||:..|        ||...|.|..:      .||:.||    |...|.
Yeast   137 SASALKSSLPPVLAGNKNDQAPLDRPQLPPRQVVNAETLHLKAPHGNATPSKSPTSAVGNSSSST 201

  Fly    44 PIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYK-- 106
            |       .:.|.|.:           ||.:........|...||:.:..::.    .||..|  
Yeast   202 P-------PTLPPRRI-----------EDPLDLAAQKHFLASTFKRNMLFYKS----EDNSIKCD 244

  Fly   107 LAESVAILRYLSAK---GKIPEHL---YPKYFVD-QSRVDEFLEWQHMSL-RLTCAMYFRTVWLE 163
            |.:::..|:..|.|   .:|||.:   :.|...| |:.:...:|..|..| |...|.|...||  
Yeast   245 LDKNILNLKEDSKKINNNEIPEEVSSFWLKVIGDYQNILINDIETLHFQLSRGIPAAYRLVVW-- 307

  Fly   164 PLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVR 228
                 :..|.||.::|        |.:.|.:|                        |.||.:||:
Yeast   308 -----QLVSYAKSKSF--------DPIYETYL------------------------TEMAPFDVQ 335

  Fly   229 IKYPKIRAWLKRVRQSCNPYYDVAHEFVYKIS 260
                :....||.:.       :|..|:|.:||
Yeast   336 ----EFENQLKMMD-------EVPSEYVKRIS 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 14/80 (18%)
GstA 47..243 CDD:223698 42/205 (20%)
GST_C_Theta 135..259 CDD:198292 26/124 (21%)
GYL1NP_013917.1 COG5210 27..569 CDD:227535 67/292 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.