DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and BUB2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_013771.1 Gene:BUB2 / 855077 SGDID:S000004659 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:42/228 - (18%)
Similarity:74/228 - (32%) Gaps:76/228 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGY------KLA 108
            ||:|.|  .|.:...||.:.:    :.|..|..::||.::     ||..|     |      :.:
Yeast     6 DLISNP--PLLLHSSLSQLRY----LILSEGLPISEDKQQ-----QRTRC-----YVWTVLSQTS 54

  Fly   109 ESVAILRYLS--AKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTP 171
            ...:..|||:  ..|.....:|.|...|.||.                  |:|   :|....|..
Yeast    55 MEASTQRYLALLKLGPPSTTIYQKIKNDTSRT------------------FQT---DPNFRNRVS 98

  Fly   172 SEAKI---ETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQ-------------- 219
            .:|.|   ..|..|.::.........:....::.|.::.:|.:..:|..|.              
Yeast    99 EDALIRCLSCFAWQTQQRRQKTRFGRIPVSTYVQGMNVLLAPLLYSCPSEPMAYQLFTKLCYEMI 163

  Fly   220 --------------TRMADYDVRIKYPKIRAWL 238
                          .::.|..:||..||:..:|
Yeast   164 PTYLTKNLNGAQNGAKLLDISLRIIDPKLSKFL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 18/78 (23%)
GstA 47..243 CDD:223698 42/228 (18%)
GST_C_Theta 135..259 CDD:198292 20/135 (15%)
BUB2NP_013771.1 COG5210 <1..304 CDD:227535 42/228 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.