DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GTT1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:225 Identity:50/225 - (22%)
Similarity:88/225 - (39%) Gaps:35/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MSAPIRYYYDLMSQPSRALFIIFRLSNMPFE-DCVVALRNGEHLTEDFKKEINRFQRVPCI---- 100
            ||.||...:.|  ..|||..:::.|.::..| :.|...|:.........|:|:...|.|.:    
Yeast     1 MSLPIIKVHWL--DHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLEVQD 63

  Fly   101 HDNGYK--LAESVAILRY-----------LSAKGKIPEHL-YPKYFVDQS----RVDEFLEWQHM 147
            .:.|.|  ||||..|.:|           :|....|.:.: |..::|:.|    .:.||:    :
Yeast    64 RETGKKKILAESGFIFQYVLQHFDHSHVLMSEDADIADQINYYLFYVEGSLQPPLMIEFI----L 124

  Fly   148 SLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRM-QMERNLDVVEEVWLEGKDFLTGSSLTVADI 211
            |......|.|...:|     .|..::...:.:.. :::...|.||....:...:|....|:.|||
Yeast   125 SKVKDSGMPFPISYL-----ARKVADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADI 184

  Fly   212 FAACEIEQTRMADYDVRIKYPKIRAWLKRV 241
            ..:..::......:.....||.|..|||.:
Yeast   185 LMSFPLQMAFERKFAAPEDYPAISKWLKTI 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 22/93 (24%)
GstA 47..243 CDD:223698 46/219 (21%)
GST_C_Theta 135..259 CDD:198292 22/112 (20%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 20/82 (24%)
GST_C_GTT1_like 93..218 CDD:198298 26/131 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.