DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GYP6

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_012491.3 Gene:GYP6 / 853406 SGDID:S000003580 Length:458 Species:Saccharomyces cerevisiae


Alignment Length:234 Identity:42/234 - (17%)
Similarity:74/234 - (31%) Gaps:69/234 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DEDQLQVAFDEVLKRRVPSRQPTNL-------RMSAPIRY---YYDLMSQPSRALFIIFRLSNMP 69
            |.|..::..|::.:......|...|       ..|..::|   :::::|.....|:....|.|..
Yeast   150 DLDLSRIMLDDIFQEPKVHAQMRQLLYNYLLIHQSEHLQYKQGFHEILSVIYLQLYHGTDLDNTD 214

  Fly    70 FEDCVVALR-----------NGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAKGKI 123
            .::.::...           |.|:|....|:...:..|: |:.|...|:.....  :..|.|.|.
Yeast   215 LQNVLIIFNKLMNQIEPIFYNEENLINWDKRVFTKIFRI-CLPDLFSKVFYQPP--KTGSGKKKN 276

  Fly   124 PEHLYPKYFVDQSRVDEFLEWQH-MSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNL 187
            .:||.      .|.:...:.|.. :.||.....|...|| :.:||...|                
Yeast   277 VDHLI------HSNLIWLIRWTRLLFLRELPLKYVLIVW-DHVLTFNYP---------------- 318

  Fly   188 DVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYD 226
                                 .|||.||.|....::.||
Yeast   319 ---------------------LDIFIACTIITLLLSIYD 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 14/89 (16%)
GstA 47..243 CDD:223698 36/195 (18%)
GST_C_Theta 135..259 CDD:198292 18/93 (19%)
GYP6NP_012491.3 TBC <145..336 CDD:214540 40/232 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.