DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GTT2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:231 Identity:48/231 - (20%)
Similarity:77/231 - (33%) Gaps:107/231 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIH-DNGYKLAESVAILRYLSAKGKIPEHLY 128
            ||::.|  ..:.|..|||...:|..: |....||.:. |:|..:||..||..|:.|         
Yeast    43 LSSVQF--VRINLWKGEHKKPEFLAK-NYSGTVPVLELDDGTLIAECTAITEYIDA--------- 95

  Fly   129 PKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEV 193
                :|.:                           |.|||:||.|..: ...|.....|::::.|
Yeast    96 ----LDGT---------------------------PTLTGKTPLEKGV-IHMMNKRAELELLDPV 128

  Fly   194 ----------------------W------------------LEGKDFLTGSSLTVAD-------I 211
                                  |                  |..:.::.|.|.::||       |
Yeast   129 SVYFHHATPGLGPEVELYQNKEWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLI 193

  Fly   212 FAACEIEQTRMADYDVRIKYPK----IRAWLKRVRQ 243
            |||.           |:::.|:    :|||.||::|
Yeast   194 FAAI-----------VKLQVPEECEALRAWYKRMQQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 19/56 (34%)
GstA 47..243 CDD:223698 47/229 (21%)
GST_C_Theta 135..259 CDD:198292 28/160 (18%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 18/53 (34%)
GST_C_GTT2_like 106..222 CDD:198291 24/125 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345124
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.