DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GSTF14

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:192 Identity:44/192 - (22%)
Similarity:82/192 - (42%) Gaps:8/192 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAK 120
            |.|||.| ....:.||...|....||..|:.|...:|.|..||.:.|...||.|..||.|||:.:
plant    17 SAALFCI-NEKGLDFELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLFEPKAITRYLAEQ 80

  Fly   121 GK-IPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQME 184
            .| :..:|.|.....::.:..::|..........:...:.:.:.| ..|....:..::..:.::.
plant    81 YKDVGTNLLPDDPKKRAIMSMWMEVDSNQFLPIASTLIKELIINP-YQGLATDDTAVQENKEKLS 144

  Fly   185 RNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYD----VRIKYPKIRAWLKRVR 242
            ..|::. |..|....:|.|.|.::||:.....|:.....|.:    :....|.:.||:::::
plant   145 EVLNIY-ETRLGESPYLAGESFSLADLHHLAPIDYLLNTDEEELKNLIYSRPNVAAWVEKMK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 25/64 (39%)
GstA 47..243 CDD:223698 44/192 (23%)
GST_C_Theta 135..259 CDD:198292 16/112 (14%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 25/63 (40%)
GST_C_Phi 94..214 CDD:198296 16/114 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.