DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GSTF6

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:222 Identity:56/222 - (25%)
Similarity:86/222 - (38%) Gaps:54/222 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 APIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKL 107
            |.|:.:....|..:|.:.|.....|:.||...|.|::|||..|.|... |.|.:||...|..:|:
plant     2 AGIKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILR-NPFGKVPAFEDGDFKI 65

  Fly   108 AESVAILRYL----SAKG-----------------KIPEHLYPKYFVDQSRVDEFLEWQHMSLRL 151
            .||.||.:|:    |.||                 :|..|.:       ..|...|.|:.:    
plant    66 FESRAITQYIAHEFSDKGNNLLSTGKDMAIIAMGIEIESHEF-------DPVGSKLVWEQV---- 119

  Fly   152 TCAMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACE 216
                      |:||. |.|..:..:|....::.:.|||.|....|.| :|.....|:.|:.....
plant   120 ----------LKPLY-GMTTDKTVVEEEEAKLAKVLDVYEHRLGESK-YLASDHFTLVDLHTIPV 172

  Fly   217 IE-----QTRMADYDVRIKYPKIRAWL 238
            |:     .|:.. :|.|   |.:.||:
plant   173 IQYLLGTPTKKL-FDER---PHVSAWV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 26/79 (33%)
GstA 47..243 CDD:223698 54/218 (25%)
GST_C_Theta 135..259 CDD:198292 25/109 (23%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 25/73 (34%)
GST_C_Phi 91..208 CDD:198296 27/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.