DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GSTF5

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001322019.1 Gene:GSTF5 / 839479 AraportID:AT1G02940 Length:281 Species:Arabidopsis thaliana


Alignment Length:223 Identity:53/223 - (23%)
Similarity:91/223 - (40%) Gaps:41/223 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESV 111
            |.|...:...|.|.::.. ..:.::...|.|..|:.....| ..||.|.:||...|.|.||.||.
plant    67 YGYPYSTNTRRVLAVLHE-KGLSYDPITVNLIAGDQKKPSF-LAINPFGQVPVFLDGGLKLTESR 129

  Fly   112 AILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYF------------RTVW--- 161
            ||..|::.             |.:||..:.|.::......|..|:.            ...|   
plant   130 AISEYIAT-------------VHKSRGTQLLNYKSYKTMGTQRMWMAIESFEFDPLTSTLTWEQS 181

  Fly   162 LEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYD 226
            ::|:...:|..:...|| ..::|:.||:.|| .|:...||..:|.|:||::....| |..|..:.
plant   182 IKPMYGLKTDYKVVNET-EAKLEKVLDIYEE-RLKNSSFLASNSFTMADLYHLPNI-QYLMDTHT 243

  Fly   227 VR--IKYPKIRAWLKRV------RQSCN 246
            .|  :..|.:|.|:..:      :::|:
plant   244 KRMFVNRPSVRRWVAEITARPAWKRACD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 22/73 (30%)
GstA 47..243 CDD:223698 52/218 (24%)
GST_C_Theta 135..259 CDD:198292 30/135 (22%)
GSTF5NP_001322019.1 GST_N_Phi 65..136 CDD:239351 22/70 (31%)
GST_C_Phi 153..270 CDD:198296 26/119 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.