DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GSTF4

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:223 Identity:55/223 - (24%)
Similarity:91/223 - (40%) Gaps:46/223 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAIL 114
            |..|..:|.:..:.....:.:|...|.|:.|||.||.| ..:|.|.:||...|...||.||.||.
plant    42 DPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPF-LSLNPFGQVPVFEDGSVKLYESRAIT 105

  Fly   115 RYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAK---- 175
            :|::             :|..||..:.|     :||....|...|:|:|.......|..:|    
plant   106 QYIA-------------YVHSSRGTQLL-----NLRSHETMATLTMWMEIEAHQFDPPASKLTWE 152

  Fly   176 --------IETFRMQMERNLDVVEEVW------LEGKDFLTGSSLTVADIFAACEIEQTRMADYD 226
                    :||.:..::.|..::|:|.      ||...||..:|.|:.|:.....| |..:....
plant   153 QVIKPIYGLETDQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLVDLHHLPNI-QYLLGTPT 216

  Fly   227 VRI--KYPKIRAWLKRV------RQSCN 246
            .::  |..|:|.|:..:      :.:|:
plant   217 KKLFEKRSKVRKWVDEITSREAWKMACD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 24/70 (34%)
GstA 47..243 CDD:223698 54/218 (25%)
GST_C_Theta 135..259 CDD:198292 30/138 (22%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 24/67 (36%)
GST_C_Phi 126..243 CDD:198296 24/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.