DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GSTT3

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:244 Identity:75/244 - (30%)
Similarity:130/244 - (53%) Gaps:22/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAE 109
            ::.|.|.|||||||:.|..:::.:.|::.::.|.|.:.|:.:| |:||...:||.|.|...||:|
plant     3 LKVYADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEF-KDINPMGKVPAIVDGKLKLSE 66

  Fly   110 SVAILRYL-SAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSE 173
            |.|||.|| ||...:.:|.||.....::|:...|:|.|.:||...|.|.....|.|.|......:
plant    67 SHAILIYLSSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPALGLPLNPK 131

  Fly   174 AKIETFRMQMERNLDVVEEVWLEGKD-FLTGSSL-TVADIFAACEIEQTRMADYDVRIK----YP 232
            |..|..:: :.::|..::..||:|.. ||.||:. ::||:...||:.|.::.|...|::    :.
plant   132 AAAEAEQL-LTKSLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQVLDDKDRLRLLSPHK 195

  Fly   233 KIRAWLKRVRQSCNPYYDVAHEFVYK-------------ISGTGPQAKL 268
            .:..|::..|::..|::|..||.:::             .|..|||:|:
plant   196 NVEQWIENTRKATMPHFDEVHEVLFRAKDRCQKQREMATASKPGPQSKI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 33/76 (43%)
GstA 47..243 CDD:223698 65/202 (32%)
GST_C_Theta 135..259 CDD:198292 34/142 (24%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 65/200 (33%)
GST_N_Theta 3..78 CDD:239348 32/75 (43%)
GST_C_Theta 92..221 CDD:198292 34/129 (26%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3657
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm1047
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.680

Return to query results.
Submit another query.