DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GSTF12

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:179 Identity:47/179 - (26%)
Similarity:67/179 - (37%) Gaps:47/179 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PSRALFIIFRLSNMPFEDCVVAL-----RNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAIL 114
            |.|.| :.|....:.||...:.|     :..|||..      ..|.:||.|.|..:||.||.||.
plant    14 PQRVL-LCFLEKGIEFEIIHIDLDTFEQKKPEHLLR------QPFGQVPAIEDGDFKLFESRAIA 71

  Fly   115 RYLSAK---------GKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLL---- 166
            ||.:.|         ||..||   :..|||        |..:.      .|:..|..:||:    
plant    72 RYYATKFADQGTNLLGKSLEH---RAIVDQ--------WADVE------TYYFNVLAQPLVINLI 119

  Fly   167 ----TGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADI 211
                .|.......:|..::::...||:... .|....||.|...|:||:
plant   120 IKPRLGEKCDVVLVEDLKVKLGVVLDIYNN-RLSSNRFLAGEEFTMADL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 24/79 (30%)
GstA 47..243 CDD:223698 47/179 (26%)
GST_C_Theta 135..259 CDD:198292 17/85 (20%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 47/179 (26%)
GST_N_Phi 2..77 CDD:239351 23/69 (33%)
GST_C_Phi 91..209 CDD:198296 21/95 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.