DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:212 Identity:51/212 - (24%)
Similarity:83/212 - (39%) Gaps:38/212 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAE 109
            ::.|.|.||.....:.:.....|..||...|.|....|....| ..:|.|.:||.:.|:...|.|
plant     3 MKLYGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSF-LSMNPFGKVPALQDDDLTLFE 66

  Fly   110 SVAILRYLSAKGK-----IPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGR 169
            |.||..|::.|.:     :..|..||.........| :|..|.:..::..::  .:.:.| |.|.
plant    67 SRAITAYIAEKHRDKGTDLTRHEDPKEAAIVKLWSE-VEAHHFNPAISAVIH--QLIVVP-LQGE 127

  Fly   170 TPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKY--- 231
            :|:.|.:|.....:.:.|||.|| .|....:|.|.:.|:||:             :.|...|   
plant   128 SPNAAIVEENLENLGKILDVYEE-RLGKTKYLAGDTYTLADL-------------HHVPYTYYFM 178

  Fly   232 -----------PKIRAW 237
                       |.::||
plant   179 KTIHAGLINDRPNVKAW 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 22/75 (29%)
GstA 47..243 CDD:223698 51/210 (24%)
GST_C_Theta 135..259 CDD:198292 25/117 (21%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 51/212 (24%)
GST_N_Phi 2..77 CDD:239351 22/74 (30%)
GST_C_Phi 92..208 CDD:198296 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.