DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and AT3G47680

DIOPT Version :10

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_190352.1 Gene:AT3G47680 / 823922 AraportID:AT3G47680 Length:302 Species:Arabidopsis thaliana


Alignment Length:41 Identity:12/41 - (29%)
Similarity:19/41 - (46%) Gaps:9/41 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESV 111
            :|..:..::.|...|||:|: .|..|.        ||.||:
plant   245 KDWELRQKDREQEKEDFEKQ-ERLSRT--------KLLESL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 12/41 (29%)
GST_C_Theta 135..259 CDD:198292
AT3G47680NP_190352.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.