DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GSTF10

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:171 Identity:47/171 - (27%)
Similarity:81/171 - (47%) Gaps:17/171 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVA 112
            |..|.:...||:..:.. ..:.||...|.|..||....:: ..|..|.::|.:.|..||:.||.|
plant     6 YAPLFASSKRAVVTLVE-KGVSFETVNVDLMKGEQRQPEY-LAIQPFGKIPVLVDGDYKIFESRA 68

  Fly   113 ILRYLSAK--GKIPEHLYPKYFVDQSRVDEFLEWQHMS-----LRLTCAMYFRTVWLEPLLTGRT 170
            |:||::.|  .:.|: |..|...::.:|:::|:.:..|     |.||..:.|     .||: |..
plant    69 IMRYIAEKYRSQGPD-LLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVF-----APLM-GFP 126

  Fly   171 PSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADI 211
            ..|..|:....::...|||. |..|...::|.|..:::||:
plant   127 ADEKVIKESEEKLAEVLDVY-EAQLSKNEYLAGDFVSLADL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 23/74 (31%)
GstA 47..243 CDD:223698 47/171 (27%)
GST_C_Theta 135..259 CDD:198292 21/82 (26%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 47/171 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.