DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GSTF9

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:213 Identity:54/213 - (25%)
Similarity:95/213 - (44%) Gaps:26/213 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAE 109
            ::.|....:.|.|||..:.. ..:.||...|.|..|||....: ..:..|..||.:.|..||:.|
plant     3 LKVYGPHFASPKRALVTLIE-KGVAFETIPVDLMKGEHKQPAY-LALQPFGTVPAVVDGDYKIFE 65

  Fly   110 SVAILRYLSAK--GKIPEHLYPKYFVDQSRVDEFLEWQHMS-----LRLTCAMYFRTVWLEPLLT 167
            |.|::||::.|  .:.|: |..|...|:.:|:::|:.:..:     |.||..:.|.:|      .
plant    66 SRAVMRYVAEKYRSQGPD-LLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASV------M 123

  Fly   168 GRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYP 232
            |....|..|:....::...|||. |..|....:|.|..:::||      :......||.|.   |
plant   124 GFPSDEKLIKESEEKLAGVLDVY-EAHLSKSKYLAGDFVSLAD------LAHLPFTDYLVG---P 178

  Fly   233 KIRAWLKRVRQSCNPYYD 250
            ..:|::.:.|:..:.::|
plant   179 IGKAYMIKDRKHVSAWWD 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 24/77 (31%)
GstA 47..243 CDD:223698 52/202 (26%)
GST_C_Theta 135..259 CDD:198292 26/121 (21%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 54/213 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.