DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GSTF3

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:183 Identity:45/183 - (24%)
Similarity:74/183 - (40%) Gaps:27/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 APIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKL 107
            |.|:.:....|..:|.:.|.....|:.||...|.|::|||..|.|... |.|.:||...|...||
plant     2 AGIKVFGHPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSR-NPFGQVPAFEDGDLKL 65

  Fly   108 AESVAILRYLSAKGKIPEHLYPKYFVDQSRVD--EFLEWQHMSLRLTCAMYFRTVWLEPLLT--- 167
            .||.||.:|::       |.|.....:....|  ...::..||:.:....:    ..:|:.:   
plant    66 FESRAITQYIA-------HRYENQGTNLLPADSKNIAQYAIMSIGIQVEAH----QFDPVASKLA 119

  Fly   168 ---------GRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADI 211
                     |....:|.:.....::.:.|||.|....|.| :|.|.:.|:.|:
plant   120 WEQVFKFNYGLNTDQAVVAEEEAKLAKVLDVYEARLKEFK-YLAGETFTLTDL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 26/75 (35%)
GstA 47..243 CDD:223698 43/179 (24%)
GST_C_Theta 135..259 CDD:198292 16/91 (18%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 44/181 (24%)
GST_N_Phi 4..78 CDD:239351 26/81 (32%)
GST_C_Phi 96..212 CDD:198296 15/81 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.