DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GDAP1L1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001243666.1 Gene:GDAP1L1 / 78997 HGNCID:4213 Length:386 Species:Homo sapiens


Alignment Length:312 Identity:54/312 - (17%)
Similarity:101/312 - (32%) Gaps:112/312 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PSRQPTNLRMSAPIRY-------YYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKK 89
            |:..|.....::|..:       |:...|..|:.:.::.....:..|:..|:|...|| .|.:..
Human    27 PAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQKVRLVIAEKGLVCEERDVSLPQSEH-KEPWFM 90

  Fly    90 EINRFQRVPCIHDNGYKLAESVAILRYL------SAKGKIP------------EH---LYPKY-F 132
            .:|..:.||.|......:::...|:.|:      ..:|:.|            ||   |.|:. .
Human    91 RLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGGGRGRCPSGFPAQPLAVPTEHVVALMPEVGS 155

  Fly   133 VDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLT--GRTPSEAKIETFR---------MQMERN 186
            :..:||   |:::.:...|....|.....|.|.||  ...|..|..|..|         |:::..
Human   156 LQHARV---LQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTDLMKLDHE 217

  Fly   187 ---------------------------------------LDVVE---------------EVWLEG 197
                                                   ||.:|               |:|   
Human   218 EEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQIEAELEKRKLENEGQKCELW--- 279

  Fly   198 KDFLTGSSLTVADIFAACEIEQTRMADYDVRIKY------PKIRAWLKRVRQ 243
               |.|.:.|:||:.....:.  |:....:..||      |.::::.:||::
Human   280 ---LCGCAFTLADVLLGATLH--RLKFLGLSKKYWEDGSRPNLQSFFERVQR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 15/88 (17%)
GstA 47..243 CDD:223698 51/295 (17%)
GST_C_Theta 135..259 CDD:198292 30/180 (17%)
GDAP1L1NP_001243666.1 GstA 47..333 CDD:223698 51/292 (17%)
GST_N_GDAP1 47..119 CDD:239350 15/72 (21%)
GST_C_GDAP1L1 220..330 CDD:198335 16/115 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154421
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.