DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Tbc1d9b

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001277689.1 Gene:Tbc1d9b / 76795 MGIID:1924045 Length:1263 Species:Mus musculus


Alignment Length:232 Identity:50/232 - (21%)
Similarity:80/232 - (34%) Gaps:80/232 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NDEDQLQVAFDEVLKRRVPSRQPTNLRMSAPIRYYYDLMSQ----PSRA-LFIIFRLSNMPFE-- 71
            |||.:........|...|..:.     :|.||.:.:.|::.    |... :|.:.|:|...|.  
Mouse   719 NDEGEAMTVLGRYLDNVVNKQS-----ISPPIPHLHALLTSGDDPPVEVDIFDLLRVSYEKFSNL 778

  Fly    72 --DCVVALRNGEHL-----TEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYP 129
              |.:..:|..:.|     .||..|. :..:.:|  .|.|:.:.|...:.....||     ||..
Mouse   779 RADDIEQMRFKQRLKVIQSLEDTAKR-SVVRAIP--GDIGFSIEELEDLYMVFKAK-----HLAS 835

  Fly   130 KY----------------FVDQSRVDEFLEWQHMSLRLTCAMYFR------TVWL----EPLLTG 168
            :|                :::|.|:|              |..||      |.|.    .|:|.|
Mouse   836 QYWGGNRSAAVHRDPSLPYLEQYRID--------------ASQFRELFASLTPWACGSHTPVLAG 886

  Fly   169 RTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSS 205
            |             |.|.||..::..:..|:|:||.|
Mouse   887 R-------------MFRLLDQNKDSLINFKEFVTGMS 910

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 18/89 (20%)
GstA 47..243 CDD:223698 42/199 (21%)
GST_C_Theta 135..259 CDD:198292 21/81 (26%)
Tbc1d9bNP_001277689.1 PH-GRAM1_TCB1D9_TCB1D9B 153..251 CDD:275420
PH-GRAM2_TCB1D9_TCB1D9B 299..394 CDD:270161
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..449
TBC 506..716 CDD:214540
EFh <856..907 CDD:298682 18/77 (23%)
EFh 887..912 CDD:197492 10/37 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 977..1002
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1075..1126
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1139..1159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.