DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Tbc1d21

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_083130.1 Gene:Tbc1d21 / 74286 MGIID:1921536 Length:336 Species:Mus musculus


Alignment Length:193 Identity:36/193 - (18%)
Similarity:65/193 - (33%) Gaps:68/193 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 EHLYPK-----YFVDQSRVDEFL----------EWQH------MSLRLTCAMYFRTVWLEPLLTG 168
            :.||.|     ..:|:.::::.|          |:|.      |..:|.......|.||......
Mouse   127 QRLYDKDPLGNVLIDKKKLEKTLLLSYVCNTKAEYQRGFHEMVMLFQLMVEHDHETFWLFQFFLQ 191

  Fly   169 RTPSEAKIETFRMQMERNLDVVEEV----------WLEGKDFLTGSSL-------------TVAD 210
            :|.....|   .:.:.:|||::..:          .|:||......||             |..|
Mouse   192 KTEHSCVI---NIGVGKNLDMLNSLITLLDPEFAEHLKGKGSGAVQSLFPWFCLCFQRAFKTFDD 253

  Fly   211 IFAACEIEQT--RMADYDVRIKYPKIRAWLKRVRQ--------------SCNPYYDV-AHEFV 256
            ::...|:..|  ...::.|.:.|    :.|:.||:              :||...|: |.|.:
Mouse   254 VWRLWEVLLTGKPCRNFQVLVAY----SMLQMVREQALLECMSGDAILMACNNLIDLDADELI 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348
GstA 47..243 CDD:223698 30/163 (18%)
GST_C_Theta 135..259 CDD:198292 32/178 (18%)
Tbc1d21NP_083130.1 TBC 62..287 CDD:214540 31/166 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.