DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Gsto2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_080895.2 Gene:Gsto2 / 68214 MGIID:1915464 Length:248 Species:Mus musculus


Alignment Length:163 Identity:39/163 - (23%)
Similarity:68/163 - (41%) Gaps:35/163 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 FQRVPCIHDNGYKLA-ESVAILRYLSAKGKIPEHLYP--KYF----VDQSRVDEFLEWQHMSLRL 151
            |.::|.:.::..:|. |||....||       :.:||  |.|    .:::|       |.|.|.|
Mouse    69 FGQIPVLENSQCQLVYESVIACEYL-------DDVYPGRKLFPYDPYERAR-------QKMLLEL 119

  Fly   152 TCAM-YFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKD--FLTGSSLTVADIFA 213
            .|.: ......|..|..||..::.|:     .:.:.|..:||: ||.::  |..|..:::.|...
Mouse   120 FCKVPPLSKECLIALRCGRDCTDLKV-----ALRQELCNMEEI-LEYQNTTFFGGDCISMIDYLV 178

  Fly   214 ACEIEQTRMADY---DVRIKYPKIRAWLKRVRQ 243
            ....|  |:..|   |.....|.:|.|:..::|
Mouse   179 WPWFE--RLDVYGLADCVNHTPMLRLWIASMKQ 209

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 8/27 (30%)
GstA 47..243 CDD:223698 38/161 (24%)
GST_C_Theta 135..259 CDD:198292 27/115 (23%)
Gsto2NP_080895.2 GST_N_Omega 6..94 CDD:239353 8/31 (26%)