DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Tbc1d8

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_006244913.1 Gene:Tbc1d8 / 680133 RGDID:1595491 Length:1150 Species:Rattus norvegicus


Alignment Length:182 Identity:33/182 - (18%)
Similarity:67/182 - (36%) Gaps:50/182 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 ALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSA--- 119
            |.|:..::..:..|:....|...|...|.|::.:.:|:.       .:...|:..::.|.|.   
  Rat   126 ASFVKGKVKALIAEETSSRLAEQEEEPEKFREALVKFEA-------RFNFPEAEKLVTYYSCCCW 183

  Fly   120 KGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYF------RTV--WLEPLLTGRTPSEAKI 176
            ||::|..                .|.::|:...|...|      :.|  |::.....||.:....
  Rat   184 KGRVPRQ----------------GWLYLSINHLCFYSFFLGKELKLVIPWVDIQKLERTSNVFLT 232

  Fly   177 ETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVR 228
            :|.|:..:.          :.:||.|  .|.:.::|...|    ::||..:|
  Rat   233 DTIRITTQN----------KERDFST--FLNLDEVFKIME----QLADVTLR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 11/65 (17%)
GstA 47..243 CDD:223698 33/182 (18%)
GST_C_Theta 135..259 CDD:198292 19/102 (19%)
Tbc1d8XP_006244913.1 PH-GRAM1_TBC1D8 171..269 CDD:270156 24/130 (18%)
PH-GRAM2_TBC1D8 311..406 CDD:270160
TBC 520..726 CDD:214540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.