DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstD10

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001287302.1 Gene:GstD10 / 59240 FlyBaseID:FBgn0042206 Length:210 Species:Drosophila melanogaster


Alignment Length:223 Identity:50/223 - (22%)
Similarity:94/223 - (42%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YYDLMSQPSRALFIIFRLSNMPFE-DCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESV 111
            ||...|.|.|::.:..:...:.|: ..::..|..|..|.::.| ||....:|.:||:|:.|.||.
  Fly     4 YYRPGSAPCRSVLMTAKALGVEFDKKTIINTRAREQFTPEYLK-INPQHTIPTLHDHGFALWESR 67

  Fly   112 AILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKI 176
            ||:.||..|....:.|:||....|:.:::.|.:...:|..:.:.|:     .|.:..:.|:.   
  Fly    68 AIMVYLVEKYGKDDKLFPKDVQKQALINQRLYFDMGTLYKSFSEYY-----YPQIFLKKPAN--- 124

  Fly   177 ETFRMQMERNLDVVE------EVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIR 235
                   |.|...:|      ..:|||:.:..|...::|||.....:....:|.:|.: :|..:.
  Fly   125 -------EENYKKIEVAFEFLNTFLEGQTYSAGGDYSLADIAFLATVSTFDVAGFDFK-RYANVA 181

  Fly   236 AWLKRVR-------------QSCNPYYD 250
            .|.:..:             |....|:|
  Fly   182 RWYENAKKLTPGWEENWAGCQEFRKYFD 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 23/73 (32%)
GstA 47..243 CDD:223698 47/214 (22%)
GST_C_Theta 135..259 CDD:198292 23/135 (17%)
GstD10NP_001287302.1 GST_N_Delta_Epsilon 1..75 CDD:239343 23/71 (32%)
PLN02473 3..196 CDD:166114 47/208 (23%)
GST_C_Delta_Epsilon 89..205 CDD:198287 21/131 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460045
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.