DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and tbc1d30

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_021331078.1 Gene:tbc1d30 / 569334 ZFINID:ZDB-GENE-030131-2064 Length:1063 Species:Danio rerio


Alignment Length:176 Identity:32/176 - (18%)
Similarity:58/176 - (32%) Gaps:86/176 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAK-IE 177
            ::||:.||  ||.|  |:.|           |.:..|:.            :.:.:...:|| .:
Zfish   143 VKYLAQKG--PEEL--KWIV-----------QEVKYRIA------------VQSAKLVRQAKRKD 180

  Fly   178 TFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAAC--EIEQTRMADYDVRIKY---PKI--- 234
            ..|.:.::|.|:|                      .||  .:.|.|..  |.|:|:   |.:   
Zfish   181 RLRQKFQKNCDIV----------------------TACLQAVSQKRRV--DTRLKFTIEPSLGKN 221

  Fly   235 --------------------RAWLKRVRQSCNPYYDVAHEFVYKIS 260
                                :.|.|||      :..:|.::::.||
Zfish   222 GFQQWYDALKAVARLPVGIPKEWRKRV------WLTLADQYLHSIS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 2/6 (33%)
GstA 47..243 CDD:223698 29/157 (18%)
GST_C_Theta 135..259 CDD:198292 21/152 (14%)
tbc1d30XP_021331078.1 TBC 239..458 CDD:214540 7/29 (24%)
DUF4682 625..775 CDD:318030
HrpB7 733..>820 CDD:330448
Herpes_BLLF1 <825..>973 CDD:330317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.