DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and rabgap1l2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_694092.1 Gene:rabgap1l2 / 565728 ZFINID:ZDB-GENE-070912-414 Length:320 Species:Danio rerio


Alignment Length:272 Identity:46/272 - (16%)
Similarity:96/272 - (35%) Gaps:72/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVSFLASLLGLSNDEDQLQVAFDEVLKRRVPSRQPTNLRMSAPIRYYYDLMSQPSRALFIIFRL 65
            ::...:.|.:.|.|..||.:...||:.|.....:|                       |.::...
Zfish    80 LAQKLVTSKIALRNALDQTEDQVDELTKELSKVKQ-----------------------LLVVTEE 121

  Fly    66 SNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYPK 130
            .....|:      ....|.|.|:||:::       .::..|.:.|:     ::...:|...|..|
Zfish   122 EKRGKEE------EASQLKEMFRKELDK-------AESDIKRSNSI-----IADYKQICSQLNTK 168

  Fly   131 YFVDQSRVDEFLEWQHMSLR--LTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEV 193
            ....:...|:.|.:....|:  ..|:..|.       :.|...|.::.|....|.|....:.|:|
Zfish   169 LENQKEEADKNLAFIKSKLQECERCSRIFS-------VDGSIESCSESEDRSAQDEAKTSLREQV 226

  Fly   194 WLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRA----WLKRVRQSCNPYYDVAHE 254
             .|.:..|..:.|.:.:  :.|:|::   .::...:...:::|    |||:...|          
Zfish   227 -KELEKELAQTKLQMVE--SKCKIQE---LEHQKAVLMTELQAAKNTWLKKTLDS---------- 275

  Fly   255 FVYKISGTGPQA 266
              :|.:.:|.|:
Zfish   276 --FKTAASGQQS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 9/75 (12%)
GstA 47..243 CDD:223698 33/201 (16%)
GST_C_Theta 135..259 CDD:198292 22/129 (17%)
rabgap1l2XP_694092.1 Smc <56..>265 CDD:224117 39/238 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.