DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and eef1e1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001373479.1 Gene:eef1e1 / 565440 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio


Alignment Length:188 Identity:43/188 - (22%)
Similarity:68/188 - (36%) Gaps:54/188 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KEINRF-----QRVPCI-HDNGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHM 147
            |:.|::     ::||.: ::||..|...|.|..:|..:.|.||.|...  .:|..|.:       
Zfish    16 KKANKYSTQGGKKVPVLQNNNGPALTGLVTIACHLVKEAKRPELLGDD--AEQRAVVQ------- 71

  Fly   148 SLRLTCAMYFRTVWLEPLLTG-RTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADI 211
                        .|||..:|. ...|:.:::.....:.|        :||.|.:|.|:..|:|||
Zfish    72 ------------QWLEHRITKLDNCSKEEVKVILKDLNR--------YLEDKVYLAGNVFTLADI 116

  Fly   212 F----------------AACEIEQTRMADYDVRIKYPKIRAWLKRVRQSCNPYYDVAH 253
            .                ..|.:..:|..|:...  ||.||..|..|....|..|...|
Zfish   117 LMYYGIHHIIVELAIQEKECYLNVSRWFDHIQH--YPGIRHHLPPVVVLRNRVYPSGH 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 10/37 (27%)
GstA 47..243 CDD:223698 40/176 (23%)
GST_C_Theta 135..259 CDD:198292 29/136 (21%)
eef1e1NP_001373479.1 GST_C_AIMP3 64..161 CDD:198338 25/125 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.