DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and tbc1d9

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_692034.2 Gene:tbc1d9 / 563578 ZFINID:ZDB-GENE-060810-33 Length:1248 Species:Danio rerio


Alignment Length:201 Identity:39/201 - (19%)
Similarity:69/201 - (34%) Gaps:63/201 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VVALRNGEH-LTED-----FKKEINRFQRVPCIHDNGYKLAESVAILRYLSA---KGKIPEHLYP 129
            ::|..|..| :.||     ||:.|.:|:::       :.:.|...::.|.|.   |||:|..   
Zfish   119 IIAEYNKSHDIKEDDDTDKFKEAIAKFRKL-------FVMPEEEKLVNYYSCSYWKGKVPRQ--- 173

  Fly   130 KYFVDQSRVDEFLEWQHMSLRLTC-------------AMYFRTVWLEPLLTGRTPSEAKI----- 176
                         .|.::|:...|             ..:.....||...|...|...::     
Zfish   174 -------------GWLYLSINHICFYSYLLGKEVKLVVRWADVTQLEKSATLLLPDMVRVSTRCS 225

  Fly   177 -----------ETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIK 230
                       |||:: ||:..::.....|:.|.|....||......:..::...: .|.|.|.|
Zfish   226 EHVFSVFLNINETFKL-MEQLANIAMRQLLDNKGFEQDRSLPKLKKKSPKKVSALK-RDLDARAK 288

  Fly   231 YPKIRA 236
            ..:.||
Zfish   289 SERYRA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 12/55 (22%)
GstA 47..243 CDD:223698 39/201 (19%)
GST_C_Theta 135..259 CDD:198292 23/131 (18%)
tbc1d9XP_692034.2 PH-GRAM1_TCB1D9_TCB1D9B 154..252 CDD:275420 18/114 (16%)
PH-GRAM2_TCB1D9_TCB1D9B 301..396 CDD:270161
TBC 510..720 CDD:214540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.