Sequence 1: | NP_001162808.1 | Gene: | GstT3 / 33047 | FlyBaseID: | FBgn0031117 | Length: | 268 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_689604.6 | Gene: | tbc1d2 / 561110 | ZFINID: | ZDB-GENE-140106-100 | Length: | 926 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 40/207 - (19%) |
---|---|---|---|
Similarity: | 70/207 - (33%) | Gaps: | 85/207 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 LRNGEHLTEDFKKEINRF----------QRVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYPKY 131
Fly 132 FVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVW-- 194
Fly 195 -----LEGKDFLTGSSLTV----ADIF--------------------AACEIEQTRMADYDVRIK 230
Fly 231 YPKIRAWLKRVR 242 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT3 | NP_001162808.1 | GST_N_Theta | 45..121 | CDD:239348 | 11/53 (21%) |
GstA | 47..243 | CDD:223698 | 40/207 (19%) | ||
GST_C_Theta | 135..259 | CDD:198292 | 25/139 (18%) | ||
tbc1d2 | XP_689604.6 | PH | 56..146 | CDD:278594 | |
PH_TBC1D2A | 57..153 | CDD:269966 | |||
TBC | 621..837 | CDD:214540 | 39/206 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5210 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |