DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and tbc1d2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_689604.6 Gene:tbc1d2 / 561110 ZFINID:ZDB-GENE-140106-100 Length:926 Species:Danio rerio


Alignment Length:207 Identity:40/207 - (19%)
Similarity:70/207 - (33%) Gaps:85/207 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LRNGEHLTEDFKKEINRF----------QRVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYPKY 131
            ||.|  |..:::..:.||          :|.|   |..::|.|          |.:...||.|: 
Zfish   620 LRTG--LPHEYRVRVWRFMIQTRTKSLRERHP---DRYHELCE----------KSRSSPHLVPR- 668

  Fly   132 FVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVW-- 194
               |.::|       :...||...:|           ..|:...|:    ::||.|....  |  
Zfish   669 ---QIQLD-------LDRTLTSNKHF-----------SPPTSPLIQ----KLERVLQAFS--WHN 706

  Fly   195 -----LEGKDFLTGSSLTV----ADIF--------------------AACEIEQTRMADYDVRIK 230
                 ::|.:.|...:|.|    ||.|                    ..|:.:|..:.|..:. |
Zfish   707 PTIGYVQGLNRLAAIALLVLQEEADAFWCLVVIVEHIMPPNYFTKDLVGCQADQRVLKDLMLE-K 770

  Fly   231 YPKIRAWLKRVR 242
            .|::.|.|:.::
Zfish   771 LPRLTAHLEALK 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 11/53 (21%)
GstA 47..243 CDD:223698 40/207 (19%)
GST_C_Theta 135..259 CDD:198292 25/139 (18%)
tbc1d2XP_689604.6 PH 56..146 CDD:278594
PH_TBC1D2A 57..153 CDD:269966
TBC 621..837 CDD:214540 39/206 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.