DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and gdap1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001018511.1 Gene:gdap1 / 553702 ZFINID:ZDB-GENE-050522-424 Length:362 Species:Danio rerio


Alignment Length:312 Identity:64/312 - (20%)
Similarity:108/312 - (34%) Gaps:96/312 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GLSNDEDQLQVAFD-----EVLKRRVPSRQPTNLRMSAPIRYYYDLMSQPSRALFIIFRLSNMPF 70
            |.|.||.::.:..|     |::       :.|..:.|..|.|:: ..|..|:.:.:......:..
Zfish     9 GESQDEKEILIKKDAQDSGEIV-------ESTKTKASKLILYHW-TQSFSSQKVRLAIAEKGLQC 65

  Fly    71 EDCVVALRNGEHLTEDFKKEINRFQRVP-CIHDNGYKLAESVAILRYLSAKGKIPEHLYPKYFVD 134
            ||..|:|...|| .|.:...:|....|| .:||| :.:.:...|:.||  :....:...||...:
Zfish    66 EDYDVSLPLSEH-NEPWFMRLNPTGEVPVLVHDN-HVICDPTQIMDYL--EQNFCDEQTPKLIPE 126

  Fly   135 QS-----RVDEFLEWQHMSLRLTCAMYFRTVWLEPLLT-----------------GRTPSEAK-- 175
            :.     ||..:.|... ||::..  |.....|.|.:|                 |.|.||.|  
Zfish   127 EGSTYYHRVQHYRELLD-SLQMDA--YTHGCILHPEITVDSHIPAYATTHIRTQIGNTESELKKL 188

  Fly   176 ------------------------------IETFRMQMERNLDVV--------EEVWLEGKD--F 200
                                          ::....::|..||.|        ||...||..  :
Zfish   189 AVENPDLKDAYIAKQRRLKSKLFDHDNMKYLKKLLDELENVLDQVETELQRRSEETPEEGSQQAW 253

  Fly   201 LTGSSLTVADIFAACEIEQTRMADYDVRIKYPKI--RAWLKRVRQSCNPYYD 250
            |.|...::||:..|..:.         |:|:..:  |.|...:|.:...||:
Zfish   254 LCGDFFSIADVSLAVTLH---------RLKFLGLSRRYWGNGMRVNLETYYE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 20/76 (26%)
GstA 47..243 CDD:223698 52/262 (20%)
GST_C_Theta 135..259 CDD:198292 34/182 (19%)
gdap1NP_001018511.1 GstA 40..307 CDD:223698 56/274 (20%)
GST_N_GDAP1 40..112 CDD:239350 20/76 (26%)
GST_C_family 193..304 CDD:295467 20/113 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.