DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GstT3 and TBC1D2

DIOPT Version :9

Sequence 1:	NP_001162808.1	Gene:	GstT3 / 33047	FlyBaseID:	FBgn0031117	Length:	268	Species:	Drosophila melanogaster
Sequence 2:	NP_001254500.1	Gene:	TBC1D2 / 55357	HGNCID:	18026	Length:	928	Species:	Homo sapiens

Alignment Length:	137	Identity:	31/137 - (22%)
Similarity:	55/137 - (40%)	Gaps:	42/137 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 ASLLGLSNDEDQLQVAFDEV-----LKRRVPS--RQPTNLRMSAPIR---------YYYDLMSQP 55
            ::.|..:.|:|:|::...:|     |.|||.:  ::..:|..:|.:|         :...||.:.
Human   347 SAYLAAAEDKDRLELVRHKVRQIAELGRRVEALEQERESLAHTASLREQQVQELQQHVQLLMDKN 411

  Fly    56 SRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAK 120
            .....:|.:||              |.:|:||....::           ..|....|...:||.:
Human   412 HAKQQVICKLS--------------EKVTQDFTHPPDQ-----------SPLRPDAANRDFLSQQ 451

  Fly   121 GKIPEHL 127
            ||| |||
Human   452 GKI-EHL 457

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GstT3	NP_001162808.1	GST_N_Theta	45..121	CDD:239348	14/84 (17%)
		GstA	47..243	CDD:223698	19/81 (23%)
		GST_C_Theta	135..259	CDD:198292
TBC1D2	NP_001254500.1	Interaction with CADH1	1..169
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..39
		PH_TBC1D2A	47..147	CDD:269966
		PH	47..139	CDD:278594
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	225..275
		Interaction with RAC1. /evidence=ECO:0000269\|PubMed:20116244	295..433		21/99 (21%)
		TBC	625..837	CDD:214540
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5210
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900