Sequence 1: | NP_001162808.1 | Gene: | GstT3 / 33047 | FlyBaseID: | FBgn0031117 | Length: | 268 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060222.2 | Gene: | TBC1D8B / 54885 | HGNCID: | 24715 | Length: | 1120 | Species: | Homo sapiens |
Alignment Length: | 298 | Identity: | 52/298 - (17%) |
---|---|---|---|
Similarity: | 96/298 - (32%) | Gaps: | 120/298 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSVSFLASLLGLSNDEDQLQVAFDEVLKRRVPSRQPTNLRMSAPI-------RYYYDLMSQPSRA 58
Fly 59 LFIIFRLSNM-------------------PFEDCVVALRNGEHLTEDFKKEINRFQRVP------ 98
Fly 99 --------------------CIHDNGY---------------KLAESVAILR--------YLSAK 120
Fly 121 GKIP---------EHLYPKYFV--------------------DQSRVDEFLEWQHMSLRLTCAMY 156
Fly 157 FRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVW 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT3 | NP_001162808.1 | GST_N_Theta | 45..121 | CDD:239348 | 21/150 (14%) |
GstA | 47..243 | CDD:223698 | 40/245 (16%) | ||
GST_C_Theta | 135..259 | CDD:198292 | 14/60 (23%) | ||
TBC1D8B | NP_060222.2 | PH-GRAM1_TBC1D8B | 156..254 | CDD:275419 | 15/77 (19%) |
PH-GRAM2_TBC1D8B | 296..388 | CDD:270159 | 15/92 (16%) | ||
TBC | 486..694 | CDD:214540 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1035..1066 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5210 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |