DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and TBC1D8B

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_060222.2 Gene:TBC1D8B / 54885 HGNCID:24715 Length:1120 Species:Homo sapiens


Alignment Length:298 Identity:52/298 - (17%)
Similarity:96/298 - (32%) Gaps:120/298 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVSFLASLLGLSNDEDQLQVAFDEVLKRRVPSRQPTNLRMSAPI-------RYYYDLMSQPSRA 58
            :|.:||:....|...|.:|.:::|||.|    ..:.:|:.::..|       .:|:.:....::.
Human   180 LSTNFLSFYSFLLGSEIKLIISWDEVSK----LEKTSNVILTESIHVCSQGENHYFSMFLHINQT 240

  Fly    59 LFIIFRLSNM-------------------PFEDCVVALRNGEHLTEDFKKEINRFQRVP------ 98
            ..::.:|:|.                   |.:.....|.|..|     .::.|.|.|:|      
Human   241 YLLMEQLANYAIRRLFDKETFDNDPVLYNPLQITKRGLENRAH-----SEQFNAFFRLPKGESLK 300

  Fly    99 --------------------CIHDNGY---------------KLAESVAILR--------YLSAK 120
                                ||.:| |               .|.|.:||.:        .:|.|
Human   301 EVHECFLWVPFSHFNTHGKMCISEN-YICFASQDGNQCSVIIPLREVLAIDKTNDSSKSVIISIK 364

  Fly   121 GKIP---------EHLYPKYFV--------------------DQSRVDEFLEWQHMSLRLTCAMY 156
            ||..         |.|..|..:                    :.:...:..|.|.::.:..|:  
Human   365 GKTAFRFHEVKDFEQLVAKLRLRCGAASTQYHDISTELAISSESTEPSDNFEVQSLTSQRECS-- 427

  Fly   157 FRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVW 194
             :||..|.|:|...|.  .:||...:|.:. .:.|:.|
Human   428 -KTVNTEALMTVFHPQ--NLETLNSKMLKE-KMKEQSW 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 21/150 (14%)
GstA 47..243 CDD:223698 40/245 (16%)
GST_C_Theta 135..259 CDD:198292 14/60 (23%)
TBC1D8BNP_060222.2 PH-GRAM1_TBC1D8B 156..254 CDD:275419 15/77 (19%)
PH-GRAM2_TBC1D8B 296..388 CDD:270159 15/92 (16%)
TBC 486..694 CDD:214540
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1035..1066
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.