DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and Tbc1d5

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_008764990.1 Gene:Tbc1d5 / 501088 RGDID:1561626 Length:827 Species:Rattus norvegicus


Alignment Length:215 Identity:47/215 - (21%)
Similarity:78/215 - (36%) Gaps:67/215 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSNDE----------DQLQVAFDEVLKRRVPSR---QPTNLR-MSAPIRYYYD------LMSQPS 56
            ||.||          .:|:...::.::|..|..   |..|:| :...:.:.|.      |..|..
  Rat   142 LSQDEGSLWNKFFQDKELRSMIEQDVRRTFPEMQFFQQENVRKILTDVLFCYARENEQLLYKQGM 206

  Fly    57 RALF--IIFRL------------SNMPFEDCVVALRNGEHLTEDFKKEINRFQRV--PCI----H 101
            ..|.  |||.|            |..|.|: :..|.|.|:|..|.....::....  |..    |
  Rat   207 HELLAPIIFTLHCDHQAFLHASESAQPSEE-MKTLLNPEYLEHDAYAMFSQLMETAEPWFSTFEH 270

  Fly   102 DNGYK----------------LAESVAILRYLSAKGKIPEHLYPKY----FVDQSRVDEFLEWQH 146
            | |.|                |..:|||:..::   :|.:||..|:    ::..:|::  :..|.
  Rat   271 D-GQKGKETLMPPIPFARPQDLGPTVAIVTKVN---QIQDHLLKKHDTELYMHLNRLE--IPPQI 329

  Fly   147 MSLRLTCAMYFRTVWLEPLL 166
            ..||....::.|...|:.||
  Rat   330 YGLRWVRLLFGREFPLQDLL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 25/117 (21%)
GstA 47..243 CDD:223698 37/166 (22%)
GST_C_Theta 135..259 CDD:198292 8/32 (25%)
Tbc1d5XP_008764990.1 TBC 79..381 CDD:214540 47/215 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.