DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:222 Identity:75/222 - (33%)
Similarity:125/222 - (56%) Gaps:5/222 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SAPIRYYYDLMSQPSRALFIIFRLSNMPFEDC-VVALRNGEHLTEDFKKEINRFQRVPCIHDNGY 105
            |:.:..|.||:|||.|:::|..:.:.:||..| :..|:.|||||::|.| ::...:||.:.|..:
 Frog     3 SSELTLYLDLLSQPCRSVYIFAKANRIPFNYCKLQLLKAGEHLTQEFGK-VSVLHKVPALKDGNF 66

  Fly   106 KLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGR- 169
            .:|||.|:|.||:.|.|.|.|.||.....::||||:|.|||.:.|...:..|.|..:.|.:.|: 
 Frog    67 TMAESTAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQHTNTRPHGSKVFWTKCVSPTILGKE 131

  Fly   170 TPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKI 234
            .||| |:.....:....::..||.:|..|.|:.|..::|||:.|..||.|...:..:|..:.||:
 Frog   132 VPSE-KMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQVIASGVNVFEERPKL 195

  Fly   235 RAWLKRVRQSC-NPYYDVAHEFVYKIS 260
            .:|.:|:.::. ...:..|||::...|
 Frog   196 GSWKQRLVEAVGEELFLEAHEWILSFS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 29/76 (38%)
GstA 47..243 CDD:223698 70/197 (36%)
GST_C_Theta 135..259 CDD:198292 38/125 (30%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 29/76 (38%)
GST_C_Theta 95..221 CDD:198292 38/126 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9934
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I4248
OMA 1 1.010 - - QHG54888
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9437
Panther 1 1.100 - - LDO PTHR43917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.