DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and clic5a

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:183 Identity:34/183 - (18%)
Similarity:64/183 - (34%) Gaps:60/183 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SRALFIIFRLSNMPFEDCVVALR--------------------NGEHLTEDFKKEINRFQRVPCI 100
            |:.||:|..|..:.|....|.|:                    |||     .:.::|:.:..   
Zfish    31 SQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTPPPFLTFNGE-----VRTDVNKIEEF--- 87

  Fly   101 HDNGYKLAESVAILRY--LSAKGK----IPEHLYPKY--FVDQSRVDEFLEWQHMSLRLTCAMYF 157
                  |.|.:|..:|  |:||.|    ....::.|:  ::..::.:.....:...|::...   
Zfish    88 ------LEEMLAPPKYPKLAAKNKESNTAGNDIFAKFSAYIKNTKPEANASLEKGLLKVLKK--- 143

  Fly   158 RTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVAD 210
                |:..|....|.|...|:...:...|           :.:|.|:.||:||
Zfish   144 ----LDSFLNSPLPDEIDAESTGEEKSSN-----------RKYLDGNELTLAD 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 18/86 (21%)
GstA 47..243 CDD:223698 34/183 (19%)
GST_C_Theta 135..259 CDD:198292 13/76 (17%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 15/79 (19%)
O-ClC 10..244 CDD:129941 34/183 (19%)
GST_C_CLIC5 104..244 CDD:198330 15/96 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.