DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and gsto2

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001007373.1 Gene:gsto2 / 492500 ZFINID:ZDB-GENE-041114-67 Length:240 Species:Danio rerio


Alignment Length:200 Identity:42/200 - (21%)
Similarity:78/200 - (39%) Gaps:43/200 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RLSNMPFEDCVVALRNGEHLT-EDFKKEI---------------NRFQRVPCIH-DNGYKLAESV 111
            ||.:|.|  |..|.|....|| :..|.:|               |.|..||.:. .:|..:.||.
Zfish    24 RLYSMRF--CPFAQRTRLVLTAKGVKHDIININLVSKPDWFLKKNPFGTVPVLETSSGQVIYESP 86

  Fly   112 AILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTV-WLEPLLTGRTPSEAK 175
            ....||       :.:||:..:..|  |.|   :....::...:|.:.: :...:..|:...| .
Zfish    87 ITCEYL-------DEVYPEKKLLPS--DPF---ERAQQKMLLELYSKVIPYFYKISMGKKRGE-D 138

  Fly   176 IETFRMQM-ERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKY-----PKI 234
            :.|...:. |:.|.:.|.:..:...:..|.|:|:.|.......|:..|    :.:|:     |::
Zfish   139 VSTAEAEFTEKLLQLNEALANKKTKYFGGDSITMIDYLIWPWFERAEM----MGVKHCLAKTPEL 199

  Fly   235 RAWLK 239
            |.|::
Zfish   200 RKWIE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 20/73 (27%)
GstA 47..243 CDD:223698 42/199 (21%)
GST_C_Theta 135..259 CDD:198292 20/111 (18%)
gsto2NP_001007373.1 GST_N_Omega 4..93 CDD:239353 20/77 (26%)
GstA 25..210 CDD:223698 41/198 (21%)
GST_C_Omega 107..229 CDD:198293 18/105 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.