Sequence 1: | NP_001162808.1 | Gene: | GstT3 / 33047 | FlyBaseID: | FBgn0031117 | Length: | 268 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007373.1 | Gene: | gsto2 / 492500 | ZFINID: | ZDB-GENE-041114-67 | Length: | 240 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 42/200 - (21%) |
---|---|---|---|
Similarity: | 78/200 - (39%) | Gaps: | 43/200 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 RLSNMPFEDCVVALRNGEHLT-EDFKKEI---------------NRFQRVPCIH-DNGYKLAESV 111
Fly 112 AILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTV-WLEPLLTGRTPSEAK 175
Fly 176 IETFRMQM-ERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKY-----PKI 234
Fly 235 RAWLK 239 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT3 | NP_001162808.1 | GST_N_Theta | 45..121 | CDD:239348 | 20/73 (27%) |
GstA | 47..243 | CDD:223698 | 42/199 (21%) | ||
GST_C_Theta | 135..259 | CDD:198292 | 20/111 (18%) | ||
gsto2 | NP_001007373.1 | GST_N_Omega | 4..93 | CDD:239353 | 20/77 (26%) |
GstA | 25..210 | CDD:223698 | 41/198 (21%) | ||
GST_C_Omega | 107..229 | CDD:198293 | 18/105 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589455 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |