DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstD8

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:209 Identity:48/209 - (22%)
Similarity:90/209 - (43%) Gaps:35/209 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 YYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESV 111
            :||...|.|.|::.:..:...:.....::.:.:||.|..:|.| :|....:|.:.|:|:.:.||.
  Fly     3 FYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVK-LNPQHCIPTLVDDGFSIWESR 66

  Fly   112 AILRYLSAKGKIPEHLYPK------------YFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEP 164
            |||.||..|....:.|||.            ||...:....|:|          |:|       |
  Fly    67 AILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVE----------AIY-------P 114

  Fly   165 LLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRI 229
            .:....|::.:    .||...:.....:.:||.::::.|..||:|||.....:....:.|:|: .
  Fly   115 QIRNNHPADPE----AMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDI-A 174

  Fly   230 KYPKIRAWLKRVRQ 243
            :||.:..|.:..::
  Fly   175 QYPNVARWYENAKE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 21/73 (29%)
GstA 47..243 CDD:223698 48/207 (23%)
GST_C_Theta 135..259 CDD:198292 21/109 (19%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 48/207 (23%)
GST_N_Delta_Epsilon 1..74 CDD:239343 21/71 (30%)
GST_C_Delta_Epsilon 88..204 CDD:198287 23/123 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460044
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.