DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstD6

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:204 Identity:59/204 - (28%)
Similarity:101/204 - (49%) Gaps:15/204 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 YDLMSQPS-RALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVA 112
            |::...|| ||:.:..:...:.|....|....||.|...|.| ||....:|.:.||.:.:.|:.|
  Fly     4 YNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVK-INPQHTIPTLVDNLFVIWETRA 67

  Fly   113 ILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLL-TGRTPSEAKI 176
            |:.||..:....:.||||....|:.:::.|.:...:|....|.||     .||| ||:..::..:
  Fly    68 IVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYF-----FPLLRTGKPGTQENL 127

  Fly   177 ETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRAWLKRV 241
            |    ::....|::.. :|:|:|::.|:.|:||||.....:..|.|.|:|:: |:|.:..|.|..
  Fly   128 E----KLNAAFDLLNN-FLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLK-KFPNVDRWYKNA 186

  Fly   242 RQSCNPYYD 250
             |...|.:|
  Fly   187 -QKVTPGWD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 22/72 (31%)
GstA 47..243 CDD:223698 56/195 (29%)
GST_C_Theta 135..259 CDD:198292 33/117 (28%)
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/70 (31%)
PLN02395 11..208 CDD:166036 57/197 (29%)
GST_C_Delta_Epsilon 88..204 CDD:198287 33/119 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.