DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstD3

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:176 Identity:51/176 - (28%)
Similarity:86/176 - (48%) Gaps:11/176 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 MPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYPKYF 132
            :.|...::....||.:..||.| ||....:|.:.|||:.:.||.|||.||..|....:.||||..
  Fly     8 LEFNKKIINTLKGEQMNPDFIK-INPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDI 71

  Fly   133 VDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEG 197
            ..|:.:::.|.:....:..|.|.|:    .:...||:..||   |.:: :::...|.: ..:|||
  Fly    72 QKQAVINQRLYFDMALMYPTLANYY----YKAFTTGQFGSE---EDYK-KVQETFDFL-NTFLEG 127

  Fly   198 KDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRAWLKRVRQ 243
            :|::.|...|||||.....:....:..:|:. |||.:..|...|::
  Fly   128 QDYVAGDQYTVADIAILANVSNFDVVGFDIS-KYPNVARWYDHVKK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 19/52 (37%)
GstA 47..243 CDD:223698 51/174 (29%)
GST_C_Theta 135..259 CDD:198292 27/109 (25%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 19/50 (38%)
GstA 6..173 CDD:223698 51/176 (29%)
GST_C_Delta_Epsilon 72..188 CDD:198287 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460050
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.