Sequence 1: | NP_001162808.1 | Gene: | GstT3 / 33047 | FlyBaseID: | FBgn0031117 | Length: | 268 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002621.1 | Gene: | gsto1 / 436894 | ZFINID: | ZDB-GENE-040718-365 | Length: | 240 | Species: | Danio rerio |
Alignment Length: | 253 | Identity: | 48/253 - (18%) |
---|---|---|---|
Similarity: | 88/253 - (34%) | Gaps: | 75/253 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 RRVPSRQPTNLRMSAP-IRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEIN 92
Fly 93 RFQRVPCIH-DNGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMY 156
Fly 157 FR-TVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKD-FLTGSSLTVADIFAACEIEQ 219
Fly 220 TRMADYDVRIKY-----PKIRAWLKRVRQ----------------------SCNPYYD 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT3 | NP_001162808.1 | GST_N_Theta | 45..121 | CDD:239348 | 16/76 (21%) |
GstA | 47..243 | CDD:223698 | 37/203 (18%) | ||
GST_C_Theta | 135..259 | CDD:198292 | 24/145 (17%) | ||
gsto1 | NP_001002621.1 | GST_N_Omega | 4..93 | CDD:239353 | 22/97 (23%) |
GstA | 25..210 | CDD:223698 | 44/224 (20%) | ||
GST_C_Omega | 107..229 | CDD:198293 | 19/126 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589452 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |