Sequence 1: | NP_001162808.1 | Gene: | GstT3 / 33047 | FlyBaseID: | FBgn0031117 | Length: | 268 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002561.2 | Gene: | clic2 / 436834 | ZFINID: | ZDB-GENE-040718-299 | Length: | 239 | Species: | Danio rerio |
Alignment Length: | 231 | Identity: | 43/231 - (18%) |
---|---|---|---|
Similarity: | 75/231 - (32%) | Gaps: | 97/231 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 LFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAESVAILRYLS---AK 120
Fly 121 GKIPEHLYPKY----------------FVDQS---------------RVDEFLEWQHMSLRLTCA 154
Fly 155 MYFRTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQ 219
Fly 220 TRMADYDVRIKYPKIRAWLKRVRQSCNPYYDVAHEF 255 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT3 | NP_001162808.1 | GST_N_Theta | 45..121 | CDD:239348 | 14/64 (22%) |
GstA | 47..243 | CDD:223698 | 38/217 (18%) | ||
GST_C_Theta | 135..259 | CDD:198292 | 23/136 (17%) | ||
clic2 | NP_001002561.2 | O-ClC | 11..238 | CDD:129941 | 43/231 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589550 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |