powered by:
Protein Alignment GstT3 and CG12241
DIOPT Version :9
Sequence 1: | NP_001162808.1 |
Gene: | GstT3 / 33047 |
FlyBaseID: | FBgn0031117 |
Length: | 268 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_650432.1 |
Gene: | CG12241 / 41834 |
FlyBaseID: | FBgn0038304 |
Length: | 804 |
Species: | Drosophila melanogaster |
Alignment Length: | 75 |
Identity: | 18/75 - (24%) |
Similarity: | 31/75 - (41%) |
Gaps: | 3/75 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 87 FKKEINRFQRVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRL 151
|.:|.|.|..:..|.::....:...:.|..:.|..::...|...|. |.|||.|....:.|.|
Fly 264 FMEEENAFWMMATIVEDLLPASYYSSTLLGIQADQRVMHTLIANYL---SSVDESLRKHDIELSL 325
Fly 152 TCAMYFRTVW 161
....:|.|::
Fly 326 ITLHWFLTLF 335
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5210 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.