DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstD1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster


Alignment Length:199 Identity:55/199 - (27%)
Similarity:100/199 - (50%) Gaps:11/199 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAE 109
            :.:||...|.|.|::.:..:...:.....::.|:.||||..:|.| ||....:|.:.|||:.|.|
  Fly     2 VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLK-INPQHTIPTLVDNGFALWE 65

  Fly   110 SVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVWLEPLLTGRTPSEA 174
            |.||..||..|....:.||||....::.:::.|.:...:|..:.|.|:     .|.:..:.|::.
  Fly    66 SRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYY-----YPQVFAKAPADP 125

  Fly   175 KIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRAWLK 239
              |.|: ::|...:.: ..:|||:|:..|.|||||||.....:....:|.:::. ||..:..|.:
  Fly   126 --EAFK-KIEAAFEFL-NTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEIS-KYANVNRWYE 185

  Fly   240 RVRQ 243
            ..::
  Fly   186 NAKK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 25/75 (33%)
GstA 47..243 CDD:223698 55/195 (28%)
GST_C_Theta 135..259 CDD:198292 25/109 (23%)
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 25/73 (34%)
GstA 4..185 CDD:223698 55/191 (29%)
GST_C_Delta_Epsilon 89..205 CDD:198287 25/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460042
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.