DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and CG42795

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001287272.1 Gene:CG42795 / 41252 FlyBaseID:FBgn0261928 Length:3213 Species:Drosophila melanogaster


Alignment Length:263 Identity:55/263 - (20%)
Similarity:93/263 - (35%) Gaps:70/263 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LMSQPSRALFI--IFRLSNMPFEDCVVAL------RN------GEHLTEDFKKEINRFQRVPCIH 101
            ||....||..:  :.|.:....||...||      ||      |..:..|.|....:.::...|.
  Fly  2129 LMDNEHRASKVRRLTRANTEELEDLFQALEKQLNDRNLVKSEDGRLIRVDPKPSAEQVEQTQAIS 2193

  Fly   102 DNGYKLAESVAILRYLSAKGKIPEHLYPKYFVDQSRVD----EFLEW-----QHMSLRLTCAMYF 157
            |...::.:      :.|||   ||...||....:.:.:    |..:|     :|...|       
  Fly  2194 DLTKEIED------FTSAK---PEEENPKEAAKEDKPEPEEPEDFDWGPNTVKHHLKR------- 2242

  Fly   158 RTVWLEPLLTGRTPSEAKIETFRMQMERNLDVVEEV----------WLEGKDFLTGSSLTVADIF 212
            :||:|        ||..::|:....:||.:.::|:|          .:|.|..|..|.....|:.
  Fly  2243 KTVYL--------PSTKELESRFRSLERQIKLLEDVEKIDVEQRLNEIERKIKLQYSLSHEKDLN 2299

  Fly   213 AACEIEQTRMADYD--VRIKYPKIRAWLKRVRQ-----------SCNPYYDVAHEFVYKISGTGP 264
            ...|:.:.:..|.|  |.::.|...|.:...|.           :.:||...:.:...|...|.|
  Fly  2300 KYLELCEGKGLDDDEPVPVETPTKEAEITTARDRSRSPGRKALATKSPYTSPSRKATIKTPHTSP 2364

  Fly   265 QAK 267
            ..|
  Fly  2365 TRK 2367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 18/83 (22%)
GstA 47..243 CDD:223698 48/226 (21%)
GST_C_Theta 135..259 CDD:198292 28/155 (18%)
CG42795NP_001287272.1 RabGAP-TBC 268..443 CDD:278964
DUF4682 560..684 CDD:292361
DBP 1112..1415 CDD:289157
SWIRM-assoc_2 <2376..2482 CDD:293105
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.