DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and clic5b

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_998062.1 Gene:clic5b / 405833 ZFINID:ZDB-GENE-040426-2542 Length:408 Species:Danio rerio


Alignment Length:185 Identity:42/185 - (22%)
Similarity:67/185 - (36%) Gaps:64/185 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SRALFIIFRLSNMPFEDCVVALR--------------------NGEHLT-----EDFKKEINRFQ 95
            |:.||:|..|..:.|....|.|:                    |||..|     |:|.:|:....
Zfish   193 SQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTHPPFLTFNGEVKTDVNKIEEFLEEVLAPP 257

  Fly    96 RVPCIHDNGYKLAESVAILRYLSAKGKIPEHLYPKY--FVDQSRVDEFLEWQHMSLRLTCAMYFR 158
            :.|       |||   |..|..:|.|   ..::.|:  |:..::.|.                  
Zfish   258 KYP-------KLA---ARHRESNAAG---NDIFAKFSAFIKNTKPDA------------------ 291

  Fly   159 TVWLEPLLTGRTPSEAKIETF---RMQMERNLDVVEEVWLEGKDFLTGSSLTVAD 210
               .|.|..|.|.:..|::.:   .:..|.:.|.:||.....:.||.|:.||:||
Zfish   292 ---NEALEKGLTKALKKLDEYLNSPLPDEVDADSMEEEKASNRRFLDGNDLTLAD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 22/89 (25%)
GstA 47..243 CDD:223698 42/185 (23%)
GST_C_Theta 135..259 CDD:198292 17/79 (22%)
clic5bNP_998062.1 GST_N_CLIC 170..259 CDD:239359 15/65 (23%)
O-ClC 172..407 CDD:129941 42/185 (23%)
GST_C_CLIC5 266..406 CDD:198330 22/102 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.