DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and CG7324

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_649305.1 Gene:CG7324 / 40361 FlyBaseID:FBgn0037074 Length:1291 Species:Drosophila melanogaster


Alignment Length:283 Identity:48/283 - (16%)
Similarity:105/283 - (37%) Gaps:75/283 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DEDQLQVAFDEV-LKRRVPSRQPTNLRMSAPIRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALR 78
            :|::|.:::... :|.::|.:....:.::....|.| ::.|..:.:.....|.::......:.|:
  Fly   146 EEERLVISYSATYVKNKIPRQGQLYISLNHVCFYSY-MLGQEIKRIIRFAELEDISRNANTIYLK 209

  Fly    79 NGEHLTEDFK------------KEINRFQRVPCIHDN---------------GYKLAESVAILRY 116
            ...::|.:|.            :::|:......|||.               |.|.::...:||.
  Fly   210 TTNNMTYNFTMLFNASDAHLLIEQLNKMAIQQLIHDPDSPVVDHDTSNFSRLGSKTSKKPVLLRD 274

  Fly   117 LSAKGKIPEHLYPKYF-VDQSR-VDEFLE---WQHMSLRLTCAMYFRTVWLEP-----------L 165
            |:|:.|..|  :..|| :.||. :|..::   |...|.|.....    ::|.|           |
  Fly   275 LTARQKSEE--FRIYFRLPQSEIIDGKIKANIWTPYSKRFNSGF----IYLSPNFFCFRSDVKDL 333

  Fly   166 LTGRTP-----SEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSL-------TVADIFAACEIE 218
            ::...|     |..|.:..:.:.|..:.::..   |...|:....:       .:.|:.|...:.
  Fly   334 VSVVIPMKTIKSVEKKDDGQQRFENQIVIITS---ENVPFMFAHIVDRAVLISKITDLLARVHVP 395

  Fly   219 QTR-MADYDVRIKYPKIRAWLKR 240
            .:| .|.||:        :|.|:
  Fly   396 LSRERAKYDI--------SWSKQ 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 17/102 (17%)
GstA 47..243 CDD:223698 44/250 (18%)
GST_C_Theta 135..259 CDD:198292 23/134 (17%)
CG7324NP_649305.1 PH-GRAM1_TCB1D8_TCB1D9_family 147..249 CDD:275404 15/102 (15%)
PH-GRAM2_TCB1D9_TCB1D9B 293..389 CDD:270161 15/102 (15%)
TBC 462..670 CDD:214540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.