DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and gstt1b

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:214 Identity:73/214 - (34%)
Similarity:118/214 - (55%) Gaps:8/214 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 IRYYYDLMSQPSRALFIIFRLSNMPFEDCVVALRNGEHLTEDFKKEINRFQRVPCIHDNGYKLAE 109
            :..|.||.|||.|:::|..:.:|:.|:...::|..|....|:|.| ||..::.|.|.|..:.|||
Zfish     3 LEIYLDLFSQPCRSVYIFAKKNNIQFDYKKISLFEGYQYGEEFGK-INPLRKFPTIKDGDFCLAE 66

  Fly   110 SVAILRYLSAKGKIPEHLYPKYFVDQSRVDEFLEWQHMSLRLTCAMYFRTVW---LEPLLTGRTP 171
            ||||:.||:.|...|:|.:|.....::||:|:|.|||.|:|:..|   :.:|   |.|.:.|...
Zfish    67 SVAIMIYLADKFHTPDHWFPADLQKRARVNEYLSWQHTSIRMHGA---KIIWFKILIPEVLGAEV 128

  Fly   172 SEAKIETFRMQMERNLDVVEEVWLEGKDFLTGSSLTVADIFAACEIEQTRMADYDVRIKYPKIRA 236
            .:.|:|.....:...|.:.::.:|:.|.|:.|..:::||:.|..||.|...|..||....||::|
Zfish   129 PKEKMENAEENLNVALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAAGMDVFENRPKLKA 193

  Fly   237 WLKRVRQSCN-PYYDVAHE 254
            |..|||.:.. ..:|.||:
Zfish   194 WKDRVRVAIGAKLFDEAHQ 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 29/75 (39%)
GstA 47..243 CDD:223698 69/198 (35%)
GST_C_Theta 135..259 CDD:198292 40/124 (32%)
gstt1bNP_956878.1 GstA 1..199 CDD:223698 68/199 (34%)
GST_N_Theta 3..78 CDD:239348 29/75 (39%)
GST_C_Theta 91..217 CDD:198292 40/125 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12489
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4211
OMA 1 1.010 - - QHG54888
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm6596
orthoMCL 1 0.900 - - OOG6_100130
Panther 1 1.100 - - O PTHR43917
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.