DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT3 and GstO1

DIOPT Version :9

Sequence 1:NP_001162808.1 Gene:GstT3 / 33047 FlyBaseID:FBgn0031117 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:182 Identity:42/182 - (23%)
Similarity:63/182 - (34%) Gaps:58/182 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IFRLSNMPFEDCVVALRNGEHLTEDFKK------------------EINRFQRVPC---IHDNGY 105
            |.:|.:|.|  |..|.|  .||..|.||                  .::...:||.   :.:.|.
  Fly    21 ILKLYSMRF--CPYAHR--VHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTKVPALELVKEQGN 81

  Fly   106 K-LAESVAILRYLSAKGKIPE-HLYPKYFVDQS-------RVDEFLEWQHMSLRLTCAMYFRTVW 161
            . |.||:.|..||..  |.|| .||||..:.::       |..:|:.          |.|:..:.
  Fly    82 PVLIESLIICDYLDE--KYPEVPLYPKDLLKKAQEKILIERFGQFIN----------AFYYLLLH 134

  Fly   162 LEPLLTGRTPSEAKIETFRMQMERN------------LDVVEEVWLEGKDFL 201
            ..|.....|...|.:..:..:::|.            ||.:...|.|..|.|
  Fly   135 DNPEQLVDTDHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT3NP_001162808.1 GST_N_Theta 45..121 CDD:239348 21/80 (26%)
GstA 47..243 CDD:223698 42/182 (23%)
GST_C_Theta 135..259 CDD:198292 14/86 (16%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 20/77 (26%)
GstA 22..216 CDD:223698 41/181 (23%)
GST_C_Omega 109..234 CDD:198293 14/88 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460031
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.